EED monoclonal antibody (M05), clone 3B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EED is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EED.
Immunogen
EED (NP_003788.2, 342 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EED is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — EED
Entrez GeneID
8726GeneBank Accession#
NM_003797Protein Accession#
NP_003788.2Gene Name
EED
Gene Alias
HEED, WAIT1
Gene Description
embryonic ectoderm development
Omim ID
605984Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhancer of zeste 2, the cytoplasmic tail of integrin beta7, immunodeficiency virus type 1 (HIV-1) MA protein, and histone deacetylase proteins. This protein mediates repression of gene activity through histone deacetylation, and may act as a specific regulator of integrin function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
WD protein associating with integrin cytoplasmic tails 1
-
Interactome
-
Publication Reference
-
Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK4a regulation.
Martin N, Popov N, Aguilo F.
The EMBO Journal 2013 Apr; 32(7):982.
Application：InsituProximityLigationAssay, Human, IMR-90 cells.
-
Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK4a regulation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com