C19orf2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human C19orf2 partial ORF ( NP_003787, 371 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Interspecies Antigen Sequence
Mouse (75); Rat (74)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — C19orf2
Entrez GeneID
8725GeneBank Accession#
NM_003796Protein Accession#
NP_003787Gene Name
C19orf2
Gene Alias
FLJ10575, NNX3, RMP, URI
Gene Description
chromosome 19 open reading frame 2
Omim ID
603494Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
RNA polymerase II, subunit 5-mediating protein|RPB5-mediating protein|unconventional prefoldin RPB5 interactor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com