C19orf2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.66 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant C19orf2.
Immunogen
C19orf2 (NP_003787, 371 a.a. ~ 475 a.a) partial recombinant protein with GST tag.
Sequence
NSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (74)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.66 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — C19orf2
Entrez GeneID
8725GeneBank Accession#
NM_003796Protein Accession#
NP_003787Gene Name
C19orf2
Gene Alias
FLJ10575, NNX3, RMP, URI
Gene Description
chromosome 19 open reading frame 2
Omim ID
603494Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
RNA polymerase II, subunit 5-mediating protein|RPB5-mediating protein|unconventional prefoldin RPB5 interactor
-
Interactome
-
Disease
-
Publication Reference
-
Regulation of Androgen Receptor-Mediated Transcription by RPB5 Binding Protein URI/RMP.
Mita P, Savas JN, Djouder N, Yates JR 3rd, Ha S, Ruoff R, Schafler ED, Nwachukwu JC, Tanese N, Cowan NJ, Zavadil J, Garabedian MJ, Logan SK.
Mol Cell Biol 2011 Jul; 31:3639.
Application：IP, Human, LNCaP, PC3 cells.
-
Regulation of Androgen Receptor-Mediated Transcription by RPB5 Binding Protein URI/RMP.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com