Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C19orf2 polyclonal antibody (A01)

  • Catalog # : H00008725-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant C19orf2.
  • Immunogen:
  • C19orf2 (NP_003787, 371 a.a. ~ 475 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008725-A01
    Western Blot detection against Immunogen (37.66 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8725
  • Gene Name:
  • C19orf2
  • Gene Alias:
  • FLJ10575,NNX3,RMP,URI
  • Gene Description:
  • chromosome 19 open reading frame 2
  • Gene Summary:
  • The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • RNA polymerase II, subunit 5-mediating protein,RPB5-mediating protein,unconventional prefoldin RPB5 interactor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook