Product Browser

Last updated: 2017/4/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDF1 (Human) Recombinant Protein (P01)

  • Catalog # : H00008721-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EDF1 full-length ORF ( AAH15500.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQSRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.02
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008721-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8721
  • Gene Name:
  • EDF1
  • Gene Alias:
  • EDF-1,MBF1,MGC9058
  • Gene Description:
  • endothelial differentiation-related factor 1
  • Gene Summary:
  • This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022616,OTTHUMP00000022617,multiprotein bridging factor 1,multiprotein bridging factor-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook