MBTPS1 monoclonal antibody (M07), clone 2E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MBTPS1 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MBTPS1 on HeLa cell . [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MBTPS1.
Immunogen
MBTPS1 (NP_957720.1, 246 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MBTPS1 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MBTPS1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MBTPS1
Entrez GeneID
8720GeneBank Accession#
NM_201268Protein Accession#
NP_957720.1Gene Name
MBTPS1
Gene Alias
KIAA0091, MGC138711, MGC138712, PCSK8, S1P, SKI-1
Gene Description
membrane-bound transcription factor peptidase, site 1
Omim ID
603355Gene Ontology
HyperlinkGene Summary
The encoded protein has a central role in the regulation of lipid metabolism in cells. It is a sterol-regulated subtilisin-like serine protease that cleaves ER membrane-bound sterol regulatory element-binding proteins (SREBPs), a reaction that initiates the two-step proteolytic process by which transcriptionally active fragments of SREBPs are released from the membrane for translocation to the nucleus. The gene product is an integral membrane ER protein, with the bulk located in the ER lumen. It is synthesized as an inactive preproprotein that is self-activated by an intramolecular cleavage that generates the mature protein. [provided by RefSeq
Other Designations
membrane-bound transcription factor protease, site 1|membrane-bound transcription factor site-1 protease|site-1 protease|subtilisin/kexin isozyme-1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com