Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF25 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008718-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF25 partial ORF ( NP_003781, 28 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.41
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008718-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8718
  • Gene Name:
  • TNFRSF25
  • Gene Alias:
  • APO-3,DDR3,DR3,LARD,TNFRSF12,TR3,TRAMP,WSL-1,WSL-LR
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 25
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000000922,OTTHUMP00000000925,apoptosis inducing receptor,apoptosis-mediating receptor,death domain receptor 3 soluble form,death receptor beta,lymphocyte associated receptor of death,translocating chain-association membrane protein,tumor necrosis
  • RSS
  • YouTube
  • Linkedin
  • Facebook