Product Browser

Last updated: 2017/9/24
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRADD monoclonal antibody (M01), clone 3G1

  • Catalog # : H00008717-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TRADD.
  • Immunogen:
  • TRADD (NP_003780, 203 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TRADD monoclonal antibody (M01), clone 3G1. Western Blot analysis of TRADD expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TRADD is approximately 10ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8717
  • Gene Name:
  • TRADD
  • Gene Alias:
  • Hs.89862,MGC11078
  • Gene Description:
  • TNFRSF1A-associated via death domain
  • Gene Summary:
  • The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. [provided by RefSeq
  • Other Designations:
  • TNFR1-associated death domain protein,tumor necrosis factor receptor type 1 associated death domain protein,tumor necrosis factor receptor-1-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook