HYAL2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HYAL2.
Immunogen
HYAL2 (NP_003764, 340 a.a. ~ 439 a.a) partial recombinant protein with GST tag.
Sequence
CQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (79)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — HYAL2
Entrez GeneID
8692GeneBank Accession#
NM_003773Protein Accession#
NP_003764Gene Name
HYAL2
Gene Alias
LUCA2, LuCa-2
Gene Description
hyaluronoglucosaminidase 2
Omim ID
603551Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. Varying functions have been described for this protein. It has been described as a lysosomal hyaluronidase which is active at a pH below 4 and specifically hydrolyzes high molecular weight hyaluronan. It has also been described as a GPI-anchored cell surface protein which does not display hyaluronidase activity but does serve as a receptor for the oncogenic virus Jaagsiekte sheep retrovirus. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. This gene encodes two alternatively spliced transcript variants which differ only in the 5' UTR. [provided by RefSeq
Other Designations
PH-20 homolog|hyaluronidase 2|lysosomal hyaluronidase
-
Interactome
-
Pathway
-
Publication Reference
-
Hyaluronan synthases and hyaluronidases in nasal polyps.
Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS.
European Archives of Oto-Rhino-Laryngology 2016 Jul; 273(7):1801.
Application：IHC-P, Human, Human nasal polyps.
-
Reactive oxygen species and hyaluronidase 2 regulate airway epithelial hyaluronan fragmentation.
Monzon ME, Fregien N, Schmid N, Santos-Falcon N, Campos M, Casalino-Matsuda SM, Malbran Forteza R.
The Journal of Biological Chemistry 2010 Aug; 285(34):26126.
Application：ELISA, IF, WB-Tr, Human, NHBE cells.
-
Hyaluronidase Expression and Activity Is Regulated by Pro-Inflammatory Cytokines in Human Airway Epithelial Cells.
Monzon ME, Manzanares D, Schmid N, Casalino-Matsuda SM, Forteza RM.
American Journal of Respiratory Cell and Molecular Biology 2008 Apr; 39(3):289.
-
Hyaluronan synthases and hyaluronidases in nasal polyps.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com