Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC4A4 polyclonal antibody (A01)

  • Catalog # : H00008671-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC4A4.
  • Immunogen:
  • SLC4A4 (NP_003750, 121 a.a. ~ 229 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008671-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8671
  • Gene Name:
  • SLC4A4
  • Gene Alias:
  • DKFZp781H1314,HNBC1,KNBC,NBC1,NBC2,SLC4A5,hhNMC,pNBC
  • Gene Description:
  • solute carrier family 4, sodium bicarbonate cotransporter, member 4
  • Gene Summary:
  • This gene encodes a sodium bicarbonate cotransporter (NBC) involved in the regulation of bicarbonate secretion and absorption and intracellular pH. Mutations in this gene are associated with proximal renal tubular acidosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney; sodium bicarbonate cotransporter, pancreas),solute carrier family 4, sodium bicarbonate cotransporter, member 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook