Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF3S1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008669-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EIF3S1 partial ORF ( NP_003749, 157 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.96
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008669-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8669
  • Gene Name:
  • EIF3J
  • Gene Alias:
  • EIF3S1,eIF3-alpha,eIF3-p35
  • Gene Description:
  • eukaryotic translation initiation factor 3, subunit J
  • Gene Summary:
  • Eukaryotic initiation factor-3 (EIF3) has a molecular mass of about 600 kD and contains 13 nonidentical protein subunits, including EIF3J. EIF3 plays a central role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex (Fraser et al., 2004 [PubMed 14688252]; Fraser et al., 2007 [PubMed 17588516]).[supplied by OMIM
  • Other Designations:
  • eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD),eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook