Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF3S1 polyclonal antibody (A01)

  • Catalog # : H00008669-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EIF3S1.
  • Immunogen:
  • EIF3S1 (NP_003749, 157 a.a. ~ 258 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008669-A01
    Western Blot detection against Immunogen (37.33 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8669
  • Gene Name:
  • EIF3J
  • Gene Alias:
  • EIF3S1,eIF3-alpha,eIF3-p35
  • Gene Description:
  • eukaryotic translation initiation factor 3, subunit J
  • Gene Summary:
  • Eukaryotic initiation factor-3 (EIF3) has a molecular mass of about 600 kD and contains 13 nonidentical protein subunits, including EIF3J. EIF3 plays a central role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex (Fraser et al., 2004 [PubMed 14688252]; Fraser et al., 2007 [PubMed 17588516]).[supplied by OMIM
  • Other Designations:
  • eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD),eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook