Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF3S10 polyclonal antibody (A01)

  • Catalog # : H00008661-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EIF3S10.
  • Immunogen:
  • EIF3S10 (NP_003741, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008661-A01
    Western Blot detection against Immunogen (34.36 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8661
  • Gene Name:
  • EIF3A
  • Gene Alias:
  • EIF3,EIF3S10,KIAA0139,P167,TIF32,eIF3-p170,eIF3-theta,p180,p185
  • Gene Description:
  • eukaryotic translation initiation factor 3, subunit A
  • Other Designations:
  • EIF3, p180 subunit,OTTHUMP00000020589,centrosomin homolog,cytoplasmic protein p167,eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD),eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD),eukaryotic translation initi
  • RSS
  • YouTube
  • Linkedin
  • Facebook