DYNLL1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DYNLL1 partial ORF ( NP_003737.1, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.66
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DYNLL1
Entrez GeneID
8655GeneBank Accession#
NM_003746Protein Accession#
NP_003737.1Gene Name
DYNLL1
Gene Alias
DLC1, DLC8, DNCL1, DNCLC1, LC8, LC8a, MGC126137, MGC126138, PIN, hdlc1
Gene Description
dynein, light chain, LC8-type 1
Omim ID
601562Gene Ontology
HyperlinkGene Summary
Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq
Other Designations
8 kDa dynein light chain|cytoplasmic dynein light polypeptide|dynein light chain 1|dynein, cytoplasmic, light polypeptide 1|protein inhibitor of neuronal nitric oxide synthase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com