Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DYNLL1 (Human) Recombinant Protein (P01)

  • Catalog # : H00008655-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DYNLL1 full-length ORF ( NP_003737.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008655-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8655
  • Gene Name:
  • DYNLL1
  • Gene Alias:
  • DLC1,DLC8,DNCL1,DNCLC1,LC8,LC8a,MGC126137,MGC126138,PIN,hdlc1
  • Gene Description:
  • dynein, light chain, LC8-type 1
  • Gene Summary:
  • Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq
  • Other Designations:
  • 8 kDa dynein light chain,cytoplasmic dynein light polypeptide,dynein light chain 1,dynein, cytoplasmic, light polypeptide 1,protein inhibitor of neuronal nitric oxide synthase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook