Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDE5A (Human) Recombinant Protein (Q01)

  • Catalog # : H00008654-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDE5A partial ORF ( NP_001074, 29 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008654-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8654
  • Gene Name:
  • PDE5A
  • Gene Alias:
  • CGB-PDE,CN5A,PDE5,PDE5A1
  • Gene Description:
  • phosphodiesterase 5A, cGMP-specific
  • Gene Summary:
  • This gene encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • cGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase,phosphodiesterase 5A
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook