DDX3Y monoclonal antibody (M01), clone 2D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDX3Y.
Immunogen
DDX3Y (NP_004651, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (73)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DDX3Y monoclonal antibody (M01), clone 2D7. Western Blot analysis of DDX3Y expression in mouse testis.Western Blot (Cell lysate)
DDX3Y monoclonal antibody (M01), clone 2D7 Western Blot analysis of DDX3Y expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
DDX3Y monoclonal antibody (M01), clone 2D7. Western Blot analysis of DDX3Y expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
DDX3Y monoclonal antibody (M01), clone 2D7. Western Blot analysis of DDX3Y expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDX3Y is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — DDX3Y
Entrez GeneID
8653GeneBank Accession#
NM_004660Protein Accession#
NP_004651Gene Name
DDX3Y
Gene Alias
DBY
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked
Omim ID
400010Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it has a homolog on the X chromosome. The gene mutation causes male infertility, Sertoli cell-only syndrome or severe hypospermatogenesis, suggesting that this gene plays a key role in the spermatogenic process. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, Y chromosome|OTTHUMP00000034504
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com