Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAPKSP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008649-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MAPKSP1 partial ORF ( NP_068805, 1 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.31
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008649-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8649
  • Gene Name:
  • MAPKSP1
  • Gene Alias:
  • MAP2K1IP1,MAPBP,MP1
  • Gene Description:
  • MAPK scaffold protein 1
  • Gene Summary:
  • This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Multiple transcript variants are expressed by this gene, but only one variant is thought to express a protein. [provided by RefSeq
  • Other Designations:
  • MEK binding partner 1,MEK partner 1,mitogen-activated protein kinase kinase 1 interacting protein 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook