Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAPKSP1 polyclonal antibody (A01)

  • Catalog # : H00008649-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAPKSP1.
  • Immunogen:
  • MAPKSP1 (NP_068805, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008649-A01
    Western Blot detection against Immunogen (35.68 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8649
  • Gene Name:
  • MAPKSP1
  • Gene Alias:
  • MAP2K1IP1,MAPBP,MP1
  • Gene Description:
  • MAPK scaffold protein 1
  • Gene Summary:
  • This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Multiple transcript variants are expressed by this gene, but only one variant is thought to express a protein. [provided by RefSeq
  • Other Designations:
  • MEK binding partner 1,MEK partner 1,mitogen-activated protein kinase kinase 1 interacting protein 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook