Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008630-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSD17B6 partial ORF ( NP_003716.2, 180 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008630-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8630
  • Gene Name:
  • HSD17B6
  • Gene Alias:
  • HSE,RODH,SDR9C6
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
  • Gene Summary:
  • The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. [provided by RefSeq
  • Other Designations:
  • 3(alpha->beta)-hydroxysteroid epimerase,3(alpha->beta)-hydroxysteroid epimerasel,3-hydroxysteroid epimerase,NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase,hydroxysteroid (17-beta) dehydrogenase 6,oxidative 3-alpha-hydroxys
  • RSS
  • YouTube
  • Linkedin
  • Facebook