CDC2L5 monoclonal antibody (M02), clone 3G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC2L5.
Immunogen
CDC2L5 (AAH01274, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDC2L5 expression in transfected 293T cell line by CDC2L5 monoclonal antibody (M02), clone 3G1.
Lane 1: CDC2L5 transfected lysate(37 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDC2L5 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CDC2L5
Entrez GeneID
8621GeneBank Accession#
BC001274Protein Accession#
AAH01274Gene Name
CDC2L5
Gene Alias
CDC2L, CHED, FLJ35215, KIAA1791
Gene Description
cell division cycle 2-like 5 (cholinesterase-related cell division controller)
Omim ID
603309Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the cyclin-dependent serine/threonine protein kinase family. Members of this family are well known for their essential roles as master switches in cell cycle control. Some of the cell cycle control kinases are able to phosphorylate proteins that are important for cell differentiation and apoptosis, thus provide connections between cell proliferation, differentiation, and apoptosis. Proteins of this family may also be involved in non-cell cycle-related functions, such as neurocytoskeleton dynamics. The exact function of this protein has not yet been determined. It has unusually large N- and C-termini and is ubiquitously expressed in many tissues. Two alternatively spliced variants are described. [provided by RefSeq
Other Designations
CDC2-related protein kinase 5|cell division cycle 2-like 5|cell division cycle 2-like 5, isoform 1; cholinesterase-related cell division controller; CDC2-related protein kinase 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com