Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPAP2C (Human) Recombinant Protein (Q01)

  • Catalog # : H00008612-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPAP2C partial ORF ( NP_003703, 114 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.57
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008612-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8612
  • Gene Name:
  • PPAP2C
  • Gene Alias:
  • LPP2,PAP-2c,PAP2-g
  • Gene Description:
  • phosphatidic acid phosphatase type 2C
  • Gene Summary:
  • The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • lipid phosphate phosphohydrolase 2,phosphatidic acid phosphohydrolase type 2c,type-2 phosphatidic acid phosphatase-gamma
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook