PPAP2C (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPAP2C partial ORF ( NP_003703, 114 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.57
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPAP2C
Entrez GeneID
8612GeneBank Accession#
NM_003712Protein Accession#
NP_003703Gene Name
PPAP2C
Gene Alias
LPP2, PAP-2c, PAP2-g
Gene Description
phosphatidic acid phosphatase type 2C
Omim ID
607126Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
lipid phosphate phosphohydrolase 2|phosphatidic acid phosphohydrolase type 2c|type-2 phosphatidic acid phosphatase-gamma
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com