Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPAP2A (Human) Recombinant Protein (P01)

  • Catalog # : H00008611-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPAP2A full-length ORF ( AAH39847, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 56.98
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008611-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8611
  • Gene Name:
  • PPAP2A
  • Gene Alias:
  • LLP1a,LPP1,PAP-2a,PAP2,PAP2a2,PAP2alpha2,PAPalpha1
  • Gene Description:
  • phosphatidic acid phosphatase type 2A
  • Gene Summary:
  • The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of this gene is found to be regulated by androgen in a prostatic adenocarcinoma cell line. At least two alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • lipid phosphate phosphohydrolase 1,lipid phosphate phosphohydrolase 1a,phosphatidic acid phosphatase 2a,phosphatidic acid phosphohydrolase type 2a,type 2 phosphatidic acid phosphohydrolase,type-2 phosphatidic acid phosphatase alpha
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook