PPAP2A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPAP2A full-length ORF ( AAH39847, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
56.98
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPAP2A
Entrez GeneID
8611GeneBank Accession#
BC039847Protein Accession#
AAH39847Gene Name
PPAP2A
Gene Alias
LLP1a, LPP1, PAP-2a, PAP2, PAP2a2, PAP2alpha2, PAPalpha1
Gene Description
phosphatidic acid phosphatase type 2A
Omim ID
607124Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of this gene is found to be regulated by androgen in a prostatic adenocarcinoma cell line. At least two alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
lipid phosphate phosphohydrolase 1|lipid phosphate phosphohydrolase 1a|phosphatidic acid phosphatase 2a|phosphatidic acid phosphohydrolase type 2a|type 2 phosphatidic acid phosphohydrolase|type-2 phosphatidic acid phosphatase alpha
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com