PPAP2A purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PPAP2A MaxPab rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in human pancreas.
Western Blot (Cell lysate)
PPAP2A MaxPab rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of PPAP2A expression in transfected 293T cell line (H00008611-T02) by PPAP2A MaxPab polyclonal antibody.
Lane 1: PPAP2A transfected lysate(32.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PPAP2A protein.
Immunogen
PPAP2A (NP_003702.2, 1 a.a. ~ 284 a.a) full-length human protein.
Sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PPAP2A MaxPab rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in human pancreas.Western Blot (Cell lysate)
PPAP2A MaxPab rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of PPAP2A expression in transfected 293T cell line (H00008611-T02) by PPAP2A MaxPab polyclonal antibody.
Lane 1: PPAP2A transfected lysate(32.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PPAP2A
Entrez GeneID
8611GeneBank Accession#
NM_003711Protein Accession#
NP_003702.2Gene Name
PPAP2A
Gene Alias
LLP1a, LPP1, PAP-2a, PAP2, PAP2a2, PAP2alpha2, PAPalpha1
Gene Description
phosphatidic acid phosphatase type 2A
Omim ID
607124Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of this gene is found to be regulated by androgen in a prostatic adenocarcinoma cell line. At least two alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
lipid phosphate phosphohydrolase 1|lipid phosphate phosphohydrolase 1a|phosphatidic acid phosphatase 2a|phosphatidic acid phosphohydrolase type 2a|type 2 phosphatidic acid phosphohydrolase|type-2 phosphatidic acid phosphatase alpha
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com