KLF7 monoclonal antibody (M01), clone 3E8-B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KLF7.
Immunogen
KLF7 (AAH12919, 1 a.a. ~ 230 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNATTATGVFPGLTILPST
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.04 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KLF7 monoclonal antibody (M01), clone 3E8-B8. Western Blot analysis of KLF7 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
KLF7 monoclonal antibody (M01), clone 3E8-B8 Western Blot analysis of KLF7 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLF7 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — KLF7
-
Interactome
-
Disease
-
Publication Reference
-
The KLF7/PFKL/ACADL axis modulates cardiac metabolic remodelling during cardiac hypertrophy in male mice.
Cao Wang, Shupei Qiao, Yufang Zhao, Hui Tian, Wei Yan, Xiaolu Hou, Ruiqi Wang, Bosong Zhang, Chaofan Yang, Fuxing Zhu, Yanwen Jiao, Jiaming Jin, Yue Chen, Weiming Tian.
Nature Communications 2023 Feb; 14(1):959.
Application:WB-Ti, Mouse, Mouse heart.
-
Transcription factor KLF7 regulates differentiation of neuroectodermal and mesodermal cell lineages.
Caiazzo M, Colucci-D'Amato L, Esposito MT, Parisi S, Stifani S, Ramirez F, di Porzio U.
Experimental Cell Research 2010 Aug; 316(14):2365.
Application:WB-Tr, Mouse, Rat, Embryonic stem cells, PC-12 cells.
-
The KLF7/PFKL/ACADL axis modulates cardiac metabolic remodelling during cardiac hypertrophy in male mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com