KLF7 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant KLF7.
Immunogen
KLF7 (AAH12919, 1 a.a. ~ 230 a.a) full-length recombinant protein with GST tag.
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNATTATGVFPGLTILPST
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.41 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — KLF7
-
Interactome
-
Disease
-
Publication Reference
-
KLF7 Regulates Satellite Cell Quiescence in Response to Extracellular Signaling.
Wang X, Shen QW, Wang J, Zhang Z, Feng F, Chen T, Zhang Y, Wei H, Li Z, Wang X, Wang Y.
Stem Cells 2016 May; 34(5):1310.
Application:WB-Ce, Mouse, C2C12 cells, Mouse satellite cells.
-
MiR-146b is a regulator of human visceral preadipocyte proliferation and differentiation and its expression is altered in human obesity.
Chen L, Dai YM, Ji CB, Yang L, Shi CM, Xu GF, Pang LX, Huang FY, Zhang CM, Guo XR.
Molecular and Cellular Endocrinology 2014 Aug; 393(1-2):65.
Application:WB-Tr, Human, Preadipocytes.
-
(-)-Catechin suppresses expression of Kruppel-like factor 7 and increases expression and secretion of adiponectin protein in 3T3-L1 cells.
Cho SY, Park PJ, Shin HJ, Kim YK, Shin DW, Shin ES, Lee HH, Lee BG, Baik JH, Lee TR.
American Journal of Physiology. Endocrinology and Metabolism 2006 Dec; 292(4):E1166.
Application:WB-Ce, Mouse, 3T3-L1 cells.
-
KLF7 Regulates Satellite Cell Quiescence in Response to Extracellular Signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com