Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RDH16 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00008608-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RDH16 protein.
  • Immunogen:
  • RDH16 (AAI60081.1, 1 a.a. ~ 317 a.a) full-length human protein.
  • Sequence:
  • MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RDH16 MaxPab polyclonal antibody. Western Blot analysis of RDH16 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RDH16 expression in transfected 293T cell line (H00008608-T01) by RDH16 MaxPab polyclonal antibody.

    Lane 1: RDH16 transfected lysate(34.87 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8608
  • Gene Name:
  • RDH16
  • Gene Alias:
  • RODH-4,SDR9C8
  • Gene Description:
  • retinol dehydrogenase 16 (all-trans)
  • Other Designations:
  • microsomal NAD+-dependent retinol dehydrogenase 4,retinol dehydrogenase 16,retinol dehydrogenase 16 (all-trans and 13-cis),short chain dehydrogenase/reductase family 9C, member 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook