Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC25A12 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008604-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC25A12 partial ORF ( NP_003696.2, 112 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.66
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008604-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8604
  • Gene Name:
  • SLC25A12
  • Gene Alias:
  • ARALAR,ARALAR1
  • Gene Description:
  • solute carrier family 25 (mitochondrial carrier, Aralar), member 12
  • Gene Summary:
  • This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in the gene encoding this protein may be associated with risk of autism. [provided by RefSeq
  • Other Designations:
  • calcium binding mitochondrial carrier superfamily member Aralar
  • RSS
  • YouTube
  • Linkedin
  • Facebook