RGS20 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RGS20 MaxPab rabbit polyclonal antibody. Western Blot analysis of RGS20 expression in mouse spleen.
Western Blot (Transfected lysate)
Western Blot analysis of RGS20 expression in transfected 293T cell line (H00008601-T02) by RGS20 MaxPab polyclonal antibody.
Lane 1: RGS20 transfected lysate(27.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RGS20 protein.
Immunogen
RGS20 (NP_003693.2, 1 a.a. ~ 241 a.a) full-length human protein.
Sequence
MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (84); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RGS20 MaxPab rabbit polyclonal antibody. Western Blot analysis of RGS20 expression in mouse spleen.Western Blot (Transfected lysate)
Western Blot analysis of RGS20 expression in transfected 293T cell line (H00008601-T02) by RGS20 MaxPab polyclonal antibody.
Lane 1: RGS20 transfected lysate(27.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RGS20
Entrez GeneID
8601GeneBank Accession#
NM_003702Protein Accession#
NP_003693.2Gene Name
RGS20
Gene Alias
RGSZ1, ZGAP1
Gene Description
regulator of G-protein signaling 20
Omim ID
607193Gene Ontology
HyperlinkGene Summary
Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi (see GNAI1; MIM 139310) and Gq (see GNAQ; MIM 600998) class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.[supplied by OMIM
Other Designations
regulator of G-protein signalling 20|regulator of Gz-selective protein signaling
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com