PDXK monoclonal antibody (M03), clone 4G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PDXK expression in transfected 293T cell line by PDXK monoclonal antibody (M03), clone 4G6.
Lane 1: PDXK transfected lysate(35.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDXK is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (60.06 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PDXK.
Immunogen
PDXK (AAH00123, 1 a.a. ~ 312 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (60.06 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PDXK expression in transfected 293T cell line by PDXK monoclonal antibody (M03), clone 4G6.
Lane 1: PDXK transfected lysate(35.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDXK is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — PDXK
Entrez GeneID
8566GeneBank Accession#
BC000123Protein Accession#
AAH00123Gene Name
PDXK
Gene Alias
C21orf124, C21orf97, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79
Gene Description
pyridoxal (pyridoxine, vitamin B6) kinase
Omim ID
179020Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
pyridoxal kinase|pyridoxamine kinase|pyridoxine kinase|vitamin B6 kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com