PDXK purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PDXK MaxPab rabbit polyclonal antibody. Western Blot analysis of PDXK expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of PDXK expression in transfected 293T cell line (H00008566-T02) by PDXK MaxPab polyclonal antibody.
Lane 1: PDXK transfected lysate(35.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PDXK protein.
Immunogen
PDXK (NP_003672.1, 1 a.a. ~ 312 a.a) full-length human protein.
Sequence
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PDXK MaxPab rabbit polyclonal antibody. Western Blot analysis of PDXK expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of PDXK expression in transfected 293T cell line (H00008566-T02) by PDXK MaxPab polyclonal antibody.
Lane 1: PDXK transfected lysate(35.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PDXK
Entrez GeneID
8566GeneBank Accession#
NM_003681.3Protein Accession#
NP_003672.1Gene Name
PDXK
Gene Alias
C21orf124, C21orf97, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79
Gene Description
pyridoxal (pyridoxine, vitamin B6) kinase
Omim ID
179020Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
pyridoxal kinase|pyridoxamine kinase|pyridoxine kinase|vitamin B6 kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com