PDXK polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PDXK polyclonal antibody (A01), Lot # 061103JCS1 Western Blot analysis of PDXK expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PDXK.
Immunogen
PDXK (NP_003672, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag.
Sequence
HWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PDXK polyclonal antibody (A01), Lot # 061103JCS1 Western Blot analysis of PDXK expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PDXK
Entrez GeneID
8566GeneBank Accession#
NM_003681Protein Accession#
NP_003672Gene Name
PDXK
Gene Alias
C21orf124, C21orf97, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79
Gene Description
pyridoxal (pyridoxine, vitamin B6) kinase
Omim ID
179020Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
pyridoxal kinase|pyridoxamine kinase|pyridoxine kinase|vitamin B6 kinase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Long-term prednisolone treatments increase bioactive vitamin B6 synthesis in vivo.
Chang HY, Tzen JT, Lin SJ, Wu YT, Chiang EP.
The Journal of Pharmacology and Experimental Therapeutics 2011 Apr; 337(1):102.
Application：WB, Mouse, Liver, brain, kidney, heart, gastrocnemius muscle.
-
Long-term prednisolone treatments increase bioactive vitamin B6 synthesis in vivo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com