Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDXK polyclonal antibody (A01)

  • Catalog # : H00008566-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PDXK.
  • Immunogen:
  • PDXK (NP_003672, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008566-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PDXK polyclonal antibody (A01), Lot # 061103JCS1 Western Blot analysis of PDXK expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8566
  • Gene Name:
  • PDXK
  • Gene Alias:
  • C21orf124,C21orf97,DKFZp566A071,FLJ31940,FLJ37311,MGC15873,MGC31754,MGC52346,PKH,PNK,PRED79
  • Gene Description:
  • pyridoxal (pyridoxine, vitamin B6) kinase
  • Gene Summary:
  • The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • pyridoxal kinase,pyridoxamine kinase,pyridoxine kinase,vitamin B6 kinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook