Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DEGS1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008560-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DEGS1 partial ORF ( NP_003667, 226 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008560-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8560
  • Gene Name:
  • DEGS1
  • Gene Alias:
  • DEGS,DES1,Des-1,FADS7,MGC5079,MIG15,MLD
  • Gene Description:
  • degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)
  • Gene Summary:
  • This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035598,degenerative spermatocyte homolog 1, lipid desaturase,degenerative spermatocyte homolog, lipid desaturase,dihydroceramide desaturase,membrane fatty acid (lipid) desaturase,migration-inducing gene 15 protein,sphingolipid delta 4 desatura
  • RSS
  • YouTube
  • Linkedin
  • Facebook