Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC14A (Human) Recombinant Protein (Q01)

  • Catalog # : H00008556-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDC14A partial ORF ( NP_003663, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008556-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8556
  • Gene Name:
  • CDC14A
  • Gene Alias:
  • cdc14,hCDC14
  • Gene Description:
  • CDC14 cell division cycle 14 homolog A (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, suggesting a role in cell cycle control. This protein has been shown to interact with, and dephosphorylate tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splicing of this gene results in several transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • CDC10 (cell division cycle 10, S. cerevisiae, homolog),CDC14 homolog A,OTTHUMP00000012653,OTTHUMP00000012654,OTTHUMP00000012655,dual specificity protein phosphatase CDC14A
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook