Product Browser

Last updated: 2017/6/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC14A polyclonal antibody (A01)

  • Catalog # : H00008556-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CDC14A.
  • Immunogen:
  • CDC14A (NP_003663, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8556
  • Gene Name:
  • CDC14A
  • Gene Alias:
  • cdc14,hCDC14
  • Gene Description:
  • CDC14 cell division cycle 14 homolog A (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, suggesting a role in cell cycle control. This protein has been shown to interact with, and dephosphorylate tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splicing of this gene results in several transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • CDC10 (cell division cycle 10, S. cerevisiae, homolog),CDC14 homolog A,OTTHUMP00000012653,OTTHUMP00000012654,OTTHUMP00000012655,dual specificity protein phosphatase CDC14A
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook