CDC14B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CDC14B.
Immunogen
CDC14B (NP_003662, 360 a.a. ~ 459 a.a) partial recombinant protein with GST tag.
Sequence
LVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTLSISRTKTVLR
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (72); Rat (78)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDC14B polyclonal antibody (A01), Lot # 06046. Western Blot analysis of CDC14B expression in Raw 264.7.Western Blot (Cell lysate)
CDC14B polyclonal antibody (A01), Lot # 06046. Western Blot analysis of CDC14B expression in HepG2.Western Blot (Cell lysate)
CDC14B polyclonal antibody (A01), Lot # 06046. Western Blot analysis of CDC14B expression in LNCaP.Western Blot (Recombinant protein)
ELISA
-
Gene Info — CDC14B
Entrez GeneID
8555GeneBank Accession#
NM_003671Protein Accession#
NP_003662Gene Name
CDC14B
Gene Alias
CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
Gene Description
CDC14 cell division cycle 14 homolog B (S. cerevisiae)
Omim ID
603505Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
CDC14 homolog B|OTTHUMP00000021729|OTTHUMP00000021730|OTTHUMP00000063774
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com