Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC14B polyclonal antibody (A01)

  • Catalog # : H00008555-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CDC14B.
  • Immunogen:
  • CDC14B (NP_003662, 360 a.a. ~ 459 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTLSISRTKTVLR
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008555-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CDC14B polyclonal antibody (A01), Lot # 06046. Western Blot analysis of CDC14B expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CDC14B polyclonal antibody (A01), Lot # 06046. Western Blot analysis of CDC14B expression in LNCaP.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CDC14B polyclonal antibody (A01), Lot # 06046. Western Blot analysis of CDC14B expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8555
  • Gene Name:
  • CDC14B
  • Gene Alias:
  • CDC14B3,Cdc14B1,Cdc14B2,hCDC14B
  • Gene Description:
  • CDC14 cell division cycle 14 homolog B (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • CDC14 homolog B,OTTHUMP00000021729,OTTHUMP00000021730,OTTHUMP00000063774
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook