Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIAS1 (Human) Recombinant Protein (Q02)

  • Catalog # : H00008554-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIAS1 partial ORF ( NP_057250, 543 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008554-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8554
  • Gene Name:
  • PIAS1
  • Gene Alias:
  • DDXBP1,GBP,GU/RH-II,MGC141878,MGC141879,ZMIZ3
  • Gene Description:
  • protein inhibitor of activated STAT, 1
  • Gene Summary:
  • This gene encodes a member of the mammalian PIAS [protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1)] family. This member contains a putative zinc-binding motif and a highly acidic region. It inhibits STAT1-mediated gene activation and the DNA binding activity, binds to Gu protein/RNA helicase II/DEAD box polypeptide 21, and interacts with androgen receptor (AR). It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in AR initiation and maintenance of spermatogenesis. [provided by RefSeq
  • Other Designations:
  • AR interacting protein,DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1,protein inhibitor of activated STAT-1,zinc finger, MIZ-type containing 3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook