Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BHLHB2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008553-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BHLHB2 partial ORF ( NP_003661, 130 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008553-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8553
  • Gene Name:
  • BHLHE40
  • Gene Alias:
  • BHLHB2,DEC1,FLJ99214,SHARP-2,STRA13,Stra14
  • Gene Description:
  • basic helix-loop-helix family, member e40
  • Gene Summary:
  • This gene encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. The encoded protein is believed to be involved in the control of cell differentiation. [provided by RefSeq
  • Other Designations:
  • basic helix-loop-helix domain containing, class B, 2,differentially expressed in chondrocytes 1,differentiated embryo chondrocyte expressed gene 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook