BHLHB2 monoclonal antibody (M01), clone 5B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BHLHB2.
Immunogen
BHLHB2 (NP_003661, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (90)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BHLHB2 monoclonal antibody (M01), clone 5B1. Western Blot analysis of BHLHB2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
BHLHB2 monoclonal antibody (M01), clone 5B1 Western Blot analysis of BHLHB2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
BHLHB2 monoclonal antibody (M01), clone 5B1. Western Blot analysis of BHLHE40 expression in K-562.Western Blot (Cell lysate)
BHLHB2 monoclonal antibody (M01), clone 5B1. Western Blot analysis of BHLHB2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BHLHB2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BHLHE40
Entrez GeneID
8553GeneBank Accession#
NM_003670Protein Accession#
NP_003661Gene Name
BHLHE40
Gene Alias
BHLHB2, DEC1, FLJ99214, SHARP-2, STRA13, Stra14
Gene Description
basic helix-loop-helix family, member e40
Omim ID
604256Gene Ontology
HyperlinkGene Summary
This gene encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. The encoded protein is believed to be involved in the control of cell differentiation. [provided by RefSeq
Other Designations
basic helix-loop-helix domain containing, class B, 2|differentially expressed in chondrocytes 1|differentiated embryo chondrocyte expressed gene 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Hypoxia causes pancreatic β-cell dysfunction and impairs insulin secretion by activating the transcriptional repressor BHLHE40.
Tomonori Tsuyama, Yoshifumi Sato, Tatsuya Yoshizawa, Takaaki Matsuoka, Kazuya Yamagata.
EMBO reports 2023 Jun; e56227:0.
Application:WB-Ti, Mouse, Mouse BAT, Heart, HPT, islets, kidney, liver, lung, muscle. WAT.
-
MicroRNA-18a inhibits hypoxia-inducible factor 1-alpha activity and lung metastasis in basal breast cancers.
Krutilina R, Sun W, Sethuraman A, Brown M, Seagroves TN, Pfeffer LM, Ignatova T, Fan M.
Breast Cancer Research 2014 Jul; 16(4):R78.
Application:WB-Tr, Human, MB231RN-LM cells.
-
A new role for SREBP-1 transcription factors in the regulation of muscle mass and muscle cell differentiation.
Lecomte V, Meugnier E, Euthine V, Durand C, Freyssenet D, Nemoz G, Rome S, Vidal H, Lefai E.
Molecular and Cellular Biology 2009 Dec; 30(5):1182.
Application:WB, Human, Human skeletal muscle cells.
-
Hypoxia causes pancreatic β-cell dysfunction and impairs insulin secretion by activating the transcriptional repressor BHLHE40.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com