Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BHLHB2 polyclonal antibody (A01)

  • Catalog # : H00008553-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BHLHB2.
  • Immunogen:
  • BHLHB2 (NP_003661, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008553-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8553
  • Gene Name:
  • BHLHE40
  • Gene Alias:
  • BHLHB2,DEC1,FLJ99214,SHARP-2,STRA13,Stra14
  • Gene Description:
  • basic helix-loop-helix family, member e40
  • Gene Summary:
  • This gene encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. The encoded protein is believed to be involved in the control of cell differentiation. [provided by RefSeq
  • Other Designations:
  • basic helix-loop-helix domain containing, class B, 2,differentially expressed in chondrocytes 1,differentiated embryo chondrocyte expressed gene 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook