MAPKAPK5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MAPKAPK5 MaxPab polyclonal antibody. Western Blot analysis of MAPKAPK5 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of MAPKAPK5 expression in transfected 293T cell line (H00008550-T01) by MAPKAPK5 MaxPab polyclonal antibody.
Lane 1: MAPKAPK5 transfected lysate(51.81 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MAPKAPK5 protein.
Immunogen
MAPKAPK5 (NP_003659.2, 1 a.a. ~ 471 a.a) full-length human protein.
Sequence
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAPKAPK5 MaxPab polyclonal antibody. Western Blot analysis of MAPKAPK5 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of MAPKAPK5 expression in transfected 293T cell line (H00008550-T01) by MAPKAPK5 MaxPab polyclonal antibody.
Lane 1: MAPKAPK5 transfected lysate(51.81 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MAPKAPK5
Entrez GeneID
8550GeneBank Accession#
NM_003668.2Protein Accession#
NP_003659.2Gene Name
MAPKAPK5
Gene Alias
PRAK
Gene Description
mitogen-activated protein kinase-activated protein kinase 5
Omim ID
606723Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. In vitro, this kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
p38-regulated/activated protein kinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com