PIR purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PIR MaxPab polyclonal antibody. Western Blot analysis of PIR expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of PIR expression in transfected 293T cell line (H00008544-T01) by PIR MaxPab polyclonal antibody.
Lane 1: PIR transfected lysate(31.9 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PIR on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PIR protein.
Immunogen
PIR (NP_003653.1, 1 a.a. ~ 290 a.a) full-length human protein.
Sequence
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PIR MaxPab polyclonal antibody. Western Blot analysis of PIR expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of PIR expression in transfected 293T cell line (H00008544-T01) by PIR MaxPab polyclonal antibody.
Lane 1: PIR transfected lysate(31.9 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PIR on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PIR
Entrez GeneID
8544GeneBank Accession#
NM_003662.2Protein Accession#
NP_003653.1Gene Name
PIR
Gene Alias
-
Gene Description
pirin (iron-binding nuclear protein)
Omim ID
603329Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
OTTHUMP00000022961|OTTHUMP00000022962|pirin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com