PPFIA3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PPFIA3 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of PPFIA3 expression in 293 ( Cat # L026V1 ).
Western Blot detection against Immunogen (36.78 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPFIA3.
Immunogen
PPFIA3 (NP_003651, 1043 a.a. ~ 1139 a.a) partial recombinant protein with GST tag.
Sequence
NERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.78 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPFIA3 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of PPFIA3 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPFIA3
Entrez GeneID
8541GeneBank Accession#
NM_003660Protein Accession#
NP_003651Gene Name
PPFIA3
Gene Alias
KIAA0654, LPNA3, MGC126567, MGC126569
Gene Description
protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Omim ID
603144Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. Liprin family protein has been shown to localize phosphatase LAR to cell focal adhesions and may be involved in the molecular organization of presynaptic active zones. [provided by RefSeq
Other Designations
PTPRF interacting protein alpha 3|liprin|liprin-alpha 3|protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com