API5 monoclonal antibody (M01), clone 1C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
API5 monoclonal antibody (M01), clone 1C2 Western Blot analysis of API5 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged API5 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to API5 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.18 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant API5.
Immunogen
API5 (AAH17709, 400 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
API5 monoclonal antibody (M01), clone 1C2 Western Blot analysis of API5 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged API5 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to API5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — API5
-
Interactome
-
Publication Reference
-
Api5 Contributes to E2F1 Control of the G1/S Cell Cycle Phase Transition.
Garcia-Jove Navarro M, Basset C, Arcondeguy T, Touriol C, Perez G, Prats H, Lacazette E.
PLoS One 2013 Aug; 8(8):e71443.
Application：IF, Human, H1299, HeLa cells.
-
Api5 Contributes to E2F1 Control of the G1/S Cell Cycle Phase Transition.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com