BCAS1 monoclonal antibody (M03), clone 1B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BCAS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCAS1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.54 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BCAS1.
Immunogen
BCAS1 (NP_003648, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63); Rat (65)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BCAS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCAS1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — BCAS1
Entrez GeneID
8537GeneBank Accession#
NM_003657Protein Accession#
NP_003648Gene Name
BCAS1
Gene Alias
AIBC1, NABC1
Gene Description
breast carcinoma amplified sequence 1
Omim ID
602968Gene Ontology
HyperlinkGene Summary
This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com