DGKE monoclonal antibody (M03), clone 7E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1 Western Blot analysis of DGKE expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1. Western Blot analysis of DGKE expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1. Western Blot analysis of DGKE expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1. Western Blot analysis of DGKE expression in NIH/3T3(Cat # L018V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DGKE is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DGKE.
Immunogen
DGKE (NP_003638, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG3 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1 Western Blot analysis of DGKE expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1. Western Blot analysis of DGKE expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1. Western Blot analysis of DGKE expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
DGKE monoclonal antibody (M03), clone 7E1. Western Blot analysis of DGKE expression in NIH/3T3(Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DGKE is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — DGKE
Entrez GeneID
8526GeneBank Accession#
NM_003647Protein Accession#
NP_003638Gene Name
DGKE
Gene Alias
DAGK6, DGK
Gene Description
diacylglycerol kinase, epsilon 64kDa
Omim ID
601440Gene Ontology
HyperlinkGene Summary
Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. [provided by RefSeq
Other Designations
diacylglycerol kinase epsilon|diacylglycerol kinase, epsilon (64kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com