GCM1 monoclonal antibody (M05), clone 2E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GCM1.
Immunogen
GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GCM1 monoclonal antibody (M05), clone 2E11. Western Blot analysis of GCM1 expression in FHs 173 WE.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GCM1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.7 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GCM1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GCM1
Entrez GeneID
8521GeneBank Accession#
NM_003643Protein Accession#
NP_003634Gene Name
GCM1
Gene Alias
GCMA, hGCMa
Gene Description
glial cells missing homolog 1 (Drosophila)
Omim ID
603715Gene Ontology
HyperlinkGene Summary
This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq
Other Designations
GCM motif protein 1|OTTHUMP00000016631|chorion-specific transcription factor GCMa|glial cells missing homolog a
-
Interactome
-
Disease
-
Publication Reference
-
NPFF Increases Fusogenic Proteins Syncytin 1 and Syncytin 2 via GCM1 in First Trimester Primary Human Cytotrophoblast Cells.
Hua Zhu, Bo Peng, Christian Klausen, Yuyin Yi, Yan Li, Siyuan Xiong, Peter von Dadelszen, Peter C K Leung.
FASEB Journal 2020 Jul; 34(7):9419.
Application:IHC-P, WB-Ce, WB-Tr, Human, Placenta, Cytotrophoblast cells.
-
NPFF Increases Fusogenic Proteins Syncytin 1 and Syncytin 2 via GCM1 in First Trimester Primary Human Cytotrophoblast Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com