IKBKAP monoclonal antibody (M03), clone 6G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IKBKAP.
Immunogen
IKBKAP (NP_003631, 1242 a.a. ~ 1331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (77)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IKBKAP monoclonal antibody (M03), clone 6G9 Western Blot analysis of IKBKAP expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to IKBKAP on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IKBKAP is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — IKBKAP
Entrez GeneID
8518GeneBank Accession#
NM_003640Protein Accession#
NP_003631Gene Name
IKBKAP
Gene Alias
DKFZp781H1425, DYS, ELP1, FD, FLJ12497, IKAP, IKI3, TOT1
Gene Description
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. [provided by RefSeq
Other Designations
OTTHUMP00000021869|OTTHUMP00000063889
-
Interactome
-
Disease
-
Publication Reference
-
Carnosol, a diterpene present in rosemary, increases ELP1 levels in familial Dysautonomia (FD) patient-derived cells and healthy adults: a possible therapy for FD.
Sylvia L Anderson, Faaria Fasih-Ahmad, Anthony J Evans, Berish Y Rubin.
Human Molecular Genetics 2022 Oct; 31(20):3521.
Application:WB-Ce, Human, GM02343, GM04663 cells.
-
Antisense oligonucleotides correct the familial dysautonomia splicing defect in IKBKAP transgenic mice.
Sinha R, Kim YJ, Nomakuchi T, Sahashi K, Hua Y, Rigo F, Bennett CF, Krainer AR.
Nucleic Acids Research 2018 Jun; 46(10):4833.
Application:WB, Human, Mouse, Brain, GM04899 cells.
-
Familial Dysautonomia (FD) Human Embryonic Stem Cell Derived PNS Neurons Reveal that Synaptic Vesicular and Neuronal Transport Genes Are Directly or Indirectly Affected by IKBKAP Downregulation.
Lefler S, Cohen MA, Kantor G, Cheishvili D, Even A, Birger A, Turetsky T, Gil Y, Even-Ram S, Aizenman E, Bashir N, Maayan C, Razin A, Reubinoff BE, Weil M.
PloS One 2015 Oct; 10(10):e0138807.
Application:IF, Human, Neurons.
-
Carnosol, a diterpene present in rosemary, increases ELP1 levels in familial Dysautonomia (FD) patient-derived cells and healthy adults: a possible therapy for FD.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com