Product Browser

Last updated: 2017/3/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IKBKG polyclonal antibody (A01)

  • Catalog # : H00008517-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IKBKG.
  • Immunogen:
  • IKBKG (NP_003630, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008517-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8517
  • Gene Name:
  • IKBKG
  • Gene Alias:
  • AMCBX1,FIP-3,FIP3,Fip3p,IKK-gamma,IP,IP1,IP2,IPD2,NEMO
  • Gene Description:
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
  • Gene Summary:
  • This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. Multiple transcript variants encoding different isoforms have been found for this gene. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [supplied by RefSeq
  • Other Designations:
  • NFkappaB essential modulator,OTTHUMP00000026027,OTTHUMP00000026028,OTTHUMP00000026029,incontinentia pigmenti
  • RSS
  • YouTube
  • Linkedin
  • Facebook