Product Browser

Last updated: 2020/8/2

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

NIPSNAP1 (Human) Recombinant Protein (P01) 

  • Catalog # : H00008508-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NIPSNAP1 full-length ORF ( AAH02371.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 59.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008508-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8508
  • Gene Name:
  • NIPSNAP1
  • Gene Alias:
  • -
  • Gene Description:
  • nipsnap homolog 1 (C. elegans)
  • Gene Summary:
  • NIPSNAP1 protein has a strong sequence similarity to the central portion of a hypothetical protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. The NIPSNAP1 gene is located between the NF2 and pK1.3 genes on 22q12. [provided by RefSeq
  • Other Designations:
  • 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1,NIPSNAP, C. elegans, homolog 1,nipsnap homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook