Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NIPSNAP1 monoclonal antibody (M15), clone 3B7

  • Catalog # : H00008508-M15
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant NIPSNAP1.
  • Immunogen:
  • NIPSNAP1 (NP_003625.1, 185 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • YELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NIPSNAP1 expression in transfected 293T cell line by NIPSNAP1 monoclonal antibody (M15), clone 3B7.

    Lane 1: NIPSNAP1 transfected lysate (Predicted MW: 33.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8508
  • Gene Name:
  • NIPSNAP1
  • Gene Alias:
  • -
  • Gene Description:
  • nipsnap homolog 1 (C. elegans)
  • Gene Summary:
  • NIPSNAP1 protein has a strong sequence similarity to the central portion of a hypothetical protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. The NIPSNAP1 gene is located between the NF2 and pK1.3 genes on 22q12. [provided by RefSeq
  • Other Designations:
  • 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1,NIPSNAP, C. elegans, homolog 1,nipsnap homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook